Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ACSM2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACSM2A Antibody is: synthetic peptide directed towards the C-terminal region of Human ACSM2A. Synthetic peptide located within the following region: SYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSK

ACSM2A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACSM2A

ACSM2A Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 418-577 of human ACSM2A (NP_001295101.1).
Modifications Unmodified