Primary Antibodies

View as table Download

Rabbit polyclonal Anti-ASIC4

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide CKIKFAEEDAKPKEKEAGDE, corresponding to amino acid residues 7-26 of rat ASIC4.? Intracellular, N-terminus.

Rabbit Polyclonal Anti-ACCN4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the middle region of human ACCN4. Synthetic peptide located within the following region: NLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTS

Rabbit Polyclonal Anti-ACCN4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the N terminal of human ACCN4. Synthetic peptide located within the following region: SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA

ASIC4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ASIC4

ASIC4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ACCN4