Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-Collagen Valpha 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Collagen Valpha 1 Antibody: A synthesized peptide derived from human Collagen Valpha 1 |
Anti-COL5A1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 69-82 amino acids of human collagen, type V, alpha 1 |
Rabbit Polyclonal Anti-COL5A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL5A1 antibody: synthetic peptide directed towards the N terminal of human COL5A1. Synthetic peptide located within the following region: PGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLPG |
COL5A1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human COL5A1 |
Active filters
Target Symbol
- COL5A1
Conjugates
- Unconjugated