Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Goat Polyclonal Anti-E2F3 (mouse) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | C Terminus of NP_034223.1 (DLEKLPLVEDFMCS) |
Rabbit Polyclonal Anti-E2F3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F3 antibody: synthetic peptide directed towards the C terminal of human E2F3. Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK |
E2F3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human E2F3 |
E2F3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human E2F3 (NP_001230005.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- E2F3
Conjugates
- Unconjugated