Rabbit Anti-GABAB Receptor (Ser783), R2-Subunit Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser783 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GABBR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABBR2 antibody: synthetic peptide directed towards the C terminal of human GABBR2. Synthetic peptide located within the following region: QFTQNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLE |
Rabbit polyclonal GABBR2 (Ab-893) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human GABBR2. |
Mouse Monoclonal Anti-GABA-B Receptor 2 Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal GABA-B R2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to the 105 kDa GABAbR2 protein. |
GABBR2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-310 of human GABBR2 (NP_005449.5). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
