Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-GSTM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the N terminal of human GSTM1. Synthetic peptide located within the following region: KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI |
Rabbit Polyclonal Anti-GSTM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the C terminal of human GSTM1. Synthetic peptide located within the following region: PEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK |
Rabbit polyclonal GSTM1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GSTM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 184-211 amino acids from the C-terminal region of human GSTM1. |
Goat Polyclonal Antibody against GSTM1 / GSTM2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CVFSKMAVWGNK, from the C Terminus of the protein sequence according to NP_000552; NP_666533; NP_000839. |
GSTM1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human GSTM1 |
GSTM1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse GSTM1 |
GSTM1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GSTM1 |
GSTM1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human GSTM1 (NP_666533.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GSTM1
Conjugates
- Unconjugated