Primary Antibodies

Jump to Filters
View as table Download
Kir2.2 (KCNJ12) Rabbit Polyclonal Antibody
TA338595

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNJ12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ12 antibody: synthetic peptide directed towards the middle region of human KCNJ12. Synthetic peptide located within the following region: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR
Kir2.2 (KCNJ12) Rabbit Polyclonal Antibody
TA377716

USD 220.00

3 Weeks

KCNJ12 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 354-433 of human KCNJ12 (NP_066292.2).
Modifications Unmodified