Primary Antibodies

View as table Download

Rabbit polyclonal Anti-QARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-QARS antibody: synthetic peptide directed towards the N terminal of human QARS. Synthetic peptide located within the following region: DQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQV

QARS Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human QARS (NP_005042.1).
Modifications Unmodified