Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Anti-Human TL-1A Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human TL-1A |
Rabbit Polyclonal anti-TNFSF15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TNFSF15 antibody is: synthetic peptide directed towards the C-terminal region of Human TNFSF15. Synthetic peptide located within the following region: CSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQP |
TNFSF15 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TNFSF15 |
Recombinant Anti-TL1A (Clone TAN2-2)
| Applications | Bl, FC, IF |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-TL1A (Clone TAN2-2)
| Applications | Bl, FC, IF |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- TNFSF15
Conjugates
- Unconjugated
Filter by
Category
Antibody Hosts
Isotypes
Clonalities
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)