Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-UROD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UROD antibody: synthetic peptide directed towards the N terminal of human UROD. Synthetic peptide located within the following region: SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV

Rabbit anti-UROD Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human UROD

Rabbit Polyclonal Anti-Urod Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Urod antibody is: synthetic peptide directed towards the N-terminal region of Rat Urod. Synthetic peptide located within the following region: AAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTM

Carrier-free (BSA/glycerol-free) UROD mouse monoclonal antibody,clone OTI2G7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UROD mouse monoclonal antibody,clone OTI2G7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UROD mouse monoclonal antibody,clone OTI2G7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated