Goat Polyclonal Antibody against Serotonin receptor 1B / HTR1B
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SNEDFKQAFHK, from the C Terminus of the protein sequence according to NP_000854.1. |
Goat Polyclonal Antibody against Serotonin receptor 1B / HTR1B
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SNEDFKQAFHK, from the C Terminus of the protein sequence according to NP_000854.1. |
Rabbit Polyclonal Anti-HTR1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR1B antibody: synthetic peptide directed towards the N terminal of human HTR1B. Synthetic peptide located within the following region: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKV |