Primary Antibodies

Jump to Filters
View as table Download
ApoER2 (LRP8) Rabbit Polyclonal Antibody
TA326294

USD 345.00

In Stock

Rabbit polyclonal LRP8 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LRP8.
ApoER2 (LRP8) Rabbit Polyclonal Antibody
TA335542

USD 375.00

5 Days

Rabbit Polyclonal Anti-LRP8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LRP8 Antibody: synthetic peptide directed towards the middle region of human LRP8. Synthetic peptide located within the following region: ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV
ApoER2 Rabbit Antibody
TA335245

USD 375.00

5 Days

Rabbit Polyclonal Anti-Lrp8 Antibody

Reactivities Horse, Human, Mouse, Bovine, Rabbit, Sheep, Pig, Rat