Rabbit polyclonal LRP8 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LRP8. |
Rabbit polyclonal LRP8 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LRP8. |
Rabbit Polyclonal Anti-LRP8 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LRP8 Antibody: synthetic peptide directed towards the middle region of human LRP8. Synthetic peptide located within the following region: ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV |
Rabbit Polyclonal Anti-Lrp8 Antibody
Reactivities | Horse, Human, Mouse, Bovine, Rabbit, Sheep, Pig, Rat |