Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-Perilipin A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 510 of mouse Perilipin A. |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-PLIN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLIN antibody: synthetic peptide directed towards the N terminal of human PLIN. Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS |
Goat Polyclonal Antibody against PLIN (C-terminal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EPILGRAQYSQLRKK, from the C Terminus of the protein sequence according to NP_002657.2. |
Rabbit Polyclonal Anti-PLIN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PLIN1 |
Rabbit Polyclonal Anti-PLIN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PLIN1 |
Active filters
Target Symbol
- PLIN1
Isotypes
- IgG
Families
- Druggable Genome