Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-OR10A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10A2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10A2. Synthetic peptide located within the following region: SHLLVVSLFYISLSLTYFRPKSNNSPEGKKLLSLSYTVMTPMLNPIIYSL

Rabbit Polyclonal Anti-OR10A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10A2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10A2. Synthetic peptide located within the following region: YTHIAAAILKIPSAKGKNKAFSTCSSHLLVVSLFYISLSLTYFRPKSNNS

Rabbit Polyclonal Anti-OR10A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10A2 Antibody is: synthetic peptide directed towards the middle region of Human OR10A2. Synthetic peptide located within the following region: HLLVVSLFYISLSLTYFRPKSNNSPEGKKLLSLSYTVMTPMLNPIIYSLR