Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-LHPP Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Lhpp antibody is: synthetic peptide directed towards the C-terminal region of Lhpp. Synthetic peptide located within the following region: VGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLK

Rabbit Polyclonal Anti-LHPP Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LHPP antibody: synthetic peptide directed towards the middle region of human LHPP. Synthetic peptide located within the following region: ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM