Primary Antibodies

Jump to Filters
View as table Download
CYP20A1 Rabbit Polyclonal Antibody
TA344621

USD 475.00

5 Days

Rabbit Polyclonal Anti-CYP20A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP20A1 antibody: synthetic peptide directed towards the N terminal of human CYP20A1. Synthetic peptide located within the following region: ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV
CYP20A1 Rabbit Polyclonal Antibody
TA315658

USD 345.00

In Stock

Rabbit polyclonal Cytochrome P450 20A1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 20A1.