Primary Antibodies

View as table Download

Rabbit polyclonal anti-DELTA-4 antibody

Applications IHC, WB
Reactivities Human, partial reactivity to Mouse and Rat
Conjugation Unconjugated
Immunogen Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4.

Biotinylated Anti-Human sDLL-4 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen HEK293 cells derived Recombinant Human sDLL-4

Anti-Human sDLL-4 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen HEK293 cells derived Recombinant Human sDLL-4

Goat Anti-DLL4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence KNTNQKKELEVDC, from the internal region of the protein sequence according to NP_061947.1.

Rabbit polyclonal Anti-DLL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL4 antibody: synthetic peptide directed towards the N terminal of human DLL4. Synthetic peptide located within the following region: PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE

Rabbit polyclonal Anti-DLL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL4 antibody: synthetic peptide directed towards the N terminal of human DLL4. Synthetic peptide located within the following region: QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF

Rabbit Polyclonal Anti-DLL4 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DLL4