Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MCTS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCTS1 antibody: synthetic peptide directed towards the N terminal of human MCTS1. Synthetic peptide located within the following region: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV

Carrier-free (BSA/glycerol-free) MCTS1 mouse monoclonal antibody, clone OTI 2G2 (formerly 2G2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MCTS1 mouse monoclonal antibody, clone OTI2F9 (formerly 2F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MCTS1 mouse monoclonal antibody, clone OTI 5B5 (formerly 5B5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MCTS1 mouse monoclonal antibody, clone OTI 2G2 (formerly 2G2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MCTS1 mouse monoclonal antibody, clone OTI 2G2 (formerly 2G2), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

MCTS1 mouse monoclonal antibody, clone OTI 2G2 (formerly 2G2), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MCTS1 mouse monoclonal antibody, clone OTI 2G2 (formerly 2G2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MCTS1 mouse monoclonal antibody, clone OTI2F9 (formerly 2F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MCTS1 mouse monoclonal antibody, clone OTI2F9 (formerly 2F9), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

MCTS1 mouse monoclonal antibody, clone OTI2F9 (formerly 2F9), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MCTS1 mouse monoclonal antibody, clone OTI2F9 (formerly 2F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MCTS1 mouse monoclonal antibody, clone OTI 5B5 (formerly 5B5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MCTS1 mouse monoclonal antibody, clone OTI 5B5 (formerly 5B5), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

MCTS1 mouse monoclonal antibody, clone OTI 5B5 (formerly 5B5), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MCTS1 mouse monoclonal antibody, clone OTI 5B5 (formerly 5B5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated