Primary Antibodies

Jump to Filters
View as table Download
G3BP (G3BP1) Rabbit Polyclonal Antibody
TA331473

USD 375.00

5 Days

Rabbit polyclonal Anti-G3BP1 Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-G3BP1 antibody: synthetic peptide directed towards the N terminal of human G3BP1. Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP