Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-KCNIP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: ALAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKE

Rabbit Polyclonal Anti-KCNIP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS

Rabbit Polyclonal Anti-KCNIP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: KQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRLLDPDSVDDEFELST

Rabbit Polyclonal Anti-KCNIP2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: PEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQG

Rabbit Polyclonal Anti-KCNIP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the middle region of human KCNIP2. Synthetic peptide located within the following region: LQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNH

Rabbit Polyclonal Anti-KCNIP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: RGQGRKESLSDSRDLDGSYDQLTDSVDDEFELSTVCHRPEGLEQLQEQTK

Rabbit Polyclonal Anti-KCNIP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: LKQRFLKLLPCCGPQALPSVSEIGRVFRFLGDSSLPSALAAPASLRPHRP

Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI14A7 (formerly 14A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI10F10 (formerly 10F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI14A7 (formerly 14A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI14A7 (formerly 14A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI10F10 (formerly 10F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNIP2 mouse monoclonal antibody, clone OTI10F10 (formerly 10F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated