Rabbit Polyclonal Anti-SKI2W Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SKI2W antibody was raised against a 16 amino acid peptide near the amino terminus of human SKI2W. |
Rabbit Polyclonal Anti-SKI2W Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SKI2W antibody was raised against a 16 amino acid peptide near the amino terminus of human SKI2W. |
Rabbit Polyclonal Anti-SHBG Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SHBG antibody was raised against a 16 amino acid peptide near the center of human SHBG. |
USD 475.00
5 Days
Sex Hormone Binding Globulin (SHBG) mouse monoclonal antibody, clone 1A7 (MA026), Ig Fraction
Applications | ELISA, R |
Reactivities | Human |
USD 450.00
2 Weeks
Sex Hormone Binding Globulin (SHBG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 69-96 amino acids from the N-terminal region of Human SHBG. |
Rabbit Polyclonal Anti-SHBG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHBG antibody is: synthetic peptide directed towards the C-terminal region of SHBG. Synthetic peptide located within the following region: RGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH |
Rabbit Polyclonal Anti-SHBG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHBG antibody is: synthetic peptide directed towards the N-terminal region of Human SHBG. Synthetic peptide located within the following region: FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLH |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SHBG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SHBG mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) SHBG mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SHBG mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SHBG mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-SHBG Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 68-81 amino acids of Human sex hormone-binding globulin |
Anti-SHBG Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 68-81 amino acids of Human sex hormone-binding globulin |
USD 379.00
In Stock
SHBG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
SHBG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
SHBG mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
SHBG mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
SHBG mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SHBG mouse monoclonal antibody, clone OTI1A6 (formerly 1A6), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
SHBG mouse monoclonal antibody, clone OTI1A6 (formerly 1A6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
SHBG mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
SHBG mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
SHBG mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
SHBG mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
SHBG mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |