Primary Antibodies

View as table Download

GPC4 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Hamster, Human, Pig
Conjugation Unconjugated
Immunogen GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Panda, Dog, Pig (100%); Marmoset, Mouse, Elephant, Bovine, Horse (94%); Rat, Bat, Rabbit (88%).

GPC4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Gorilla, Hamster, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Bat, Hamster (100%); Marmoset, Dog, Elephant, Panda, Rabbit (94%); Bovine, Horse, Pig (88%).

GPC4 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset, Rabbit (94%); Mouse, Rat, Bovine, Panda (88%); Hamster, Horse (81%).

GPC4 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey, Rabbit
Immunogen GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from N-terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Rabbit (100%); Mouse, Rat, Dog, Panda, Platypus (94%); Opossum, Xenopus (88%).

Rabbit Polyclonal Anti-GPC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPC4 antibody is: synthetic peptide directed towards the C-terminal region of Human GPC4. Synthetic peptide located within the following region: EYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQ