Primary Antibodies

View as table Download

Rabbit polyclonal anti-MMP-7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-7.

Rabbit anti-MMP7 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MMP7

Rabbit Polyclonal Anti-MMP7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP7 Antibody: A synthesized peptide derived from human MMP7

MMP7 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from C Terminus of human MMP7 - KLH conjugated

Goat Polyclonal Antibody against MMP7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKLYGKRSNSRKK, from the C Terminus of the protein sequence according to NP_002414.1.

Rabbit Polyclonal MMP-7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human MMP7 protein (between residues 250-300) [UniProt P09237]

Rabbit Polyclonal Anti-MMP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP7 antibody: synthetic peptide directed towards the C terminal of human MMP7. Synthetic peptide located within the following region: AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK

Rabbit anti MMP-7 (Matrilysin) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human MMP-7. This sequence is identical among bovine and monkey.

Carrier-free (glycerol/BSA-free) MMP7 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MMP7 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) MMP7 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MMP7 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-MMP7 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 5-100 amino acids of human matrix metallopeptidase 7 (matrilysin, uterine)

MMP7 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications IHC
Reactivities Human
Conjugation Unconjugated

MMP7 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications IHC
Reactivities Human
Conjugation Unconjugated

MMP7 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MMP7 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MMP7 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications WB
Reactivities Human
Conjugation Unconjugated

MMP7 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

MMP7 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

MMP7 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications WB
Reactivities Human
Conjugation Unconjugated

MMP7 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MMP7 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MMP7 mouse monoclonal antibody,clone UMAB168

Applications 10k-ChIP, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MMP7 mouse monoclonal antibody,clone UMAB168

Applications 10k-ChIP, IHC, WB
Reactivities Human
Conjugation Unconjugated

MMP7 mouse monoclonal antibody,clone UMAB168

Applications 10k-ChIP, IHC, WB
Reactivities Human
Conjugation Unconjugated