Rabbit Polyclonal FIP1/RCP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the N Terminus Region |
Rabbit Polyclonal FIP1/RCP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the N Terminus Region |
Goat Anti-RAB11FIP1 / RCP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EATKEAKESKKPE, from the internal region of the protein sequence according to NP_079427.3; NP_001002814.1. |
Rabbit Polyclonal Anti-RAB11FIP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAB11FIP1 antibody is: synthetic peptide directed towards the N-terminal region of Human RAB11FIP1. Synthetic peptide located within the following region: ALLGLDKFLGRAEVDLRDLHRDQGRRKTQWYKLKSKPGKKDKERGEIEVD |