Goat Anti-SRF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QASPSRDSSTDLTQ, from the internal region of the protein sequence according to NP_003122.1. |
Goat Anti-SRF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QASPSRDSSTDLTQ, from the internal region of the protein sequence according to NP_003122.1. |
Rabbit polyclonal SRF (Ab-99) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SRF around the phosphorylation site of serine 99 (S-L-S-E-M). |
Rabbit polyclonal SRF (Ser77) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SRF around the phosphorylation site of serine 77 (L-Y-SP-G-S). |
Modifications | Phospho-specific |
Anti-SRF rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 495-508 amino acids of human serum response factor (c-fos serum response element-binding transcription factor) |
Rabbit Polyclonal Anti-SRF Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRF Antibody: A synthesized peptide derived from human SRF |
Rabbit Polyclonal SRF Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SRF |
Rabbit Polyclonal SRF (Ser99) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SRF around the phosphorylation site of Serine 99 |
Modifications | Phospho-specific |
Serum Response Factor (SRF) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 61-110 of Human SRF. |
Rabbit Polyclonal Anti-SRF Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRF antibody: synthetic peptide directed towards the N terminal of human SRF. Synthetic peptide located within the following region: ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIM |