Primary Antibodies

View as table Download

Rabbit polyclonal anti-DLX5 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DLX5.

Rabbit Polyclonal Anti-DLX5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DLX5 Antibody: synthetic peptide directed towards the middle region of human DLX5. Synthetic peptide located within the following region: KEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAE

Rabbit Polyclonal Anti-DLX5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX5 antibody: synthetic peptide directed towards the C terminal of human DLX5. Synthetic peptide located within the following region: HPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY

Goat Anti-DLX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-AYNRVPSATNQPEK, from the internal region of the protein sequence according to NP_005212.1.

Rabbit Polyclonal anti-DLX5 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX5 antibody: synthetic peptide directed towards the N terminal of human DLX5. Synthetic peptide located within the following region: NPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEK