Primary Antibodies

Jump to Filters
View as table Download
CCR2 Rabbit Polyclonal Antibody
TA344354

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-CCR2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR2 antibody: synthetic peptide directed towards the middle region of human CCR2. Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL
CCR2 Rabbit Polyclonal Antibody
TA590046

USD 409.00

In Stock

Rabbit Polyclonal CCR2 Antibody

Applications ELISA, WB
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
CCR2 Rabbit Polyclonal Antibody
TA336783

USD 457.00

5 Days

Rabbit Polyclonal CCR2 Antibody

Applications FC
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of the mouse CCR2 protein (within residues 20-100). [Swiss-Prot# P51683]
CCR2 Rabbit Polyclonal Antibody
TA350635

USD 345.00

In Stock

Rabbit Polyclonal Anti-CCR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCR2