Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-KCNH7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the middle region of human KCNH7. Synthetic peptide located within the following region: LEKSKLKSKESLSSGVHLNTASEDNLTSLLKQDSDLSLELHLRQRKTYVH

Rabbit Polyclonal Anti-KCNH7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the N terminal of human KCNH7. Synthetic peptide located within the following region: PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV