Primary Antibodies

Jump to Filters
View as table Download
KCNV2 Rabbit Polyclonal Antibody
TA316201

USD 345.00

4 Weeks

Rabbit polyclonal anti-OR4K3 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR4K3.
KCNV2 Rabbit Polyclonal Antibody
TA338726

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNV2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNV2 antibody: synthetic peptide directed towards the N terminal of human KCNV2. Synthetic peptide located within the following region: RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK