Primary Antibodies

View as table Download

KCNC4 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-KCNC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNC4 antibody: synthetic peptide directed towards the middle region of human KCNC4. Synthetic peptide located within the following region: NIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIV

KCNC4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 517-546 amino acids from the C-terminal region of human KCNC4