Rabbit Polyclonal Anti-CYP4F12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4F12 antibody: synthetic peptide directed towards the middle region of human CYP4F12. Synthetic peptide located within the following region: DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDV |
Rabbit Polyclonal Anti-CYP4F12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4F12 antibody: synthetic peptide directed towards the C terminal of human CYP4F12. Synthetic peptide located within the following region: TVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVV |
Germany
Japan
United Kingdom
China