Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PDP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDP2 antibody: synthetic peptide directed towards the middle region of human PDP2. Synthetic peptide located within the following region: LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV

Rabbit Polyclonal Anti-PDP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDP2 antibody: synthetic peptide directed towards the middle region of human PDP2. Synthetic peptide located within the following region: CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED

Rabbit polyclonal anti-Pyruvate Dehydrogenase Phosphatase 2 (PDP2) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 427 of human PDPC subunit 1.