Primary Antibodies

View as table Download

Rabbit polyclonal anti-PP4R2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PP4R2.

Rabbit Polyclonal anti-PPP4R2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP4R2 antibody: synthetic peptide directed towards the C terminal of human PPP4R2. Synthetic peptide located within the following region: DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNE