Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PPTC7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPTC7 Antibody is: synthetic peptide directed towards the C-terminal region of Human PPTC7. Synthetic peptide located within the following region: PDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACD

Rabbit Polyclonal Anti-PPTC7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPTC7 Antibody is: synthetic peptide directed towards the C-terminal region of Human PPTC7. Synthetic peptide located within the following region: LVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFD