DPP2 / DPP7 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Gibbon |
| Immunogen | DPP2 / DPP7 antibody was raised against synthetic 17 amino acid peptide from extracellular domain of human DPP7 / DPP2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Orangutan (94%); Marmoset, Horse (88%); Elephant (82%). |
DPP2 / DPP7 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Orang-Utan, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | DPP2 / DPP7 antibody was raised against synthetic 16 amino acid peptide from extracellular domain of human DPP7 / DPP2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Marmoset (100%); Gibbon (94%). |
Rabbit Polyclonal Anti-DPP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DPP7 antibody is: synthetic peptide directed towards the middle region of Human DPP7. Synthetic peptide located within the following region: FRQIKDLFLQGAYDTVRWEFGTCQPLSDEKDLTQLFMFARNAFTVLAMMD |
Rabbit Polyclonal Anti-DPP7 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | DPP2 / DPP7 antibody was raised against synthetic 18 amino acid peptide from extracellular domain of human DPP7 / DPP2. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon (100%); Gorilla, Monkey (94%). |
Germany
Japan
United Kingdom
China