Rabbit Polyclonal Anti-SIL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SIL1 Antibody: synthetic peptide directed towards the N terminal of human SIL1. Synthetic peptide located within the following region: KETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAGSHVRLNLQTGEREAK |
Goat Polyclonal Antibody against BAP / SIL1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ELLGSVNSLLKELR, from the C Terminus of the protein sequence according to NP_071909.1. |
Rabbit Polyclonal Anti-SIL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SIL1 Antibody: synthetic peptide directed towards the C terminal of human SIL1. Synthetic peptide located within the following region: KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR |
Germany
Japan
United Kingdom
China
