Primary Antibodies

View as table Download

Rabbit polyclonal anti-TFF1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant human TFF-1

Rabbit Polyclonal Anti-TFF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TFF1 antibody: synthetic peptide directed towards the middle region of human TFF1. Synthetic peptide located within the following region: PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Anti-TFF1 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 25-84 amino acids of human trefoil factor 1

Anti-TFF1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 25-84 amino acids of human trefoil factor 1