Rabbit Polyclonal antibody to VAM1 (membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 44 of VAM1 (Uniprot ID#Q9NZW5) |
Goat Polyclonal Antibody against MPP6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence QQVLENLTELPSS-C, from the N Terminus of the protein sequence according to NP_057531.2. |
Rabbit Polyclonal Anti-MPP6 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mpp6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mpp6. Synthetic peptide located within the following region: TTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGT |
Germany
Japan
United Kingdom
China
