Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-EDF1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the middle region of human EDF1. Synthetic peptide located within the following region: INEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK

Rabbit Polyclonal Anti-EDF1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the N terminal of human EDF1. Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK

EDF1 (2-14) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bovine, Canine, Chicken, Human, Monkey, Mouse, Porcine, Rat, Xenopus
Immunogen Synthetic peptide from positions 2-14 of human EDF1 (NP_003783.1)

Rabbit polyclonal Anti-EDF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the N terminal of human EDF1. Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK

Rabbit Polyclonal Anti-EDF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EDF1 antibody is: synthetic peptide directed towards the N-terminal region of Human EDF1. Synthetic peptide located within the following region: VTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNT