Primary Antibodies

View as table Download

Rabbit Polyclonal POU3F2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal POU3F2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human POU3F2.

Rabbit Polyclonal anti-POU3F2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-POU3F2 antibody: synthetic peptide directed towards the middle region of human POU3F2. Synthetic peptide located within the following region: LGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPG

Rabbit Polyclonal Anti-POU3F2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POU3F2 antibody: synthetic peptide directed towards the C terminal of human POU3F2. Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP