Primary Antibodies

View as table Download

Rabbit Polyclonal CTCF Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTCF antibody: human CTCF (CCCTC-Binding Factor), using 4 KLH coupled peptides.

Rabbit Polyclonal Anti-CTCF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEV

Rabbit Polyclonal Anti-CTCF Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEE

Rabbit polyclonal anti-CTCF (Boris) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 14 of rat BORIS

Rabbit polyclonal anti-CTCF antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CTCF affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminus of CTCF protein.