Goat Anti-EBF1 / COE1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HNQLPALANTSV, from the internal region of the protein sequence according to NP_076870.1. |
Goat Anti-EBF1 / COE1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HNQLPALANTSV, from the internal region of the protein sequence according to NP_076870.1. |
Rabbit Polyclonal Anti-EBF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EBF1 antibody: synthetic peptide directed towards (50ug) human EBF1.. Synthetic peptide located within the following region: LPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNS |
Rabbit Polyclonal anti-EBF1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EBF1 antibody: synthetic peptide directed towards the N terminal of human EBF1. Synthetic peptide located within the following region: MCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCL |