Rabbit Polyclonal antibody to Flightless I (flightless I homolog (Drosophila))
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 435 and 778 of Flightless I (Uniprot ID#Q13045) |
Rabbit Polyclonal Anti-FLII Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FLII antibody: synthetic peptide directed towards the middle region of human FLII. Synthetic peptide located within the following region: LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR |
Germany
Japan
United Kingdom
China
