Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HMGB2 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the middle region of human HMGB2. Synthetic peptide located within the following region: DREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLS

HMGB2 mouse monoclonal antibody, clone 3D2

Applications ELISA, IF, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-HMGB2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the middle region of human HMGB2. Synthetic peptide located within the following region: SEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE

HMGB2 mouse monoclonal antibody, clone 3C7

Applications ELISA, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-HMGB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the C terminal of human HMGB2. Synthetic peptide located within the following region: AAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE

Rabbit polyclonal HMGB2 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HMGB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 92-118 amino acids from the Central region of human HMGB2.

Anti-HMGB2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 166-180 amino acids of Human high mobility group box 2