Primary Antibodies

Jump to Filters
View as table Download
LHX6 (N-term) Rabbit Polyclonal Antibody
AP11386PU-N

USD 450.00

2 Weeks

LHX6 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 36-65 amino acids from the N-terminal region of human Lhx6.
LHX6 Rabbit Polyclonal Antibody
TA330601

USD 310.00

5 Days

Rabbit Polyclonal Anti-LHX6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LHX6 antibody: synthetic peptide directed towards the C terminal of human LHX6. Synthetic peptide located within the following region: LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS
LHX6 (C-term) Rabbit Polyclonal Antibody
AP52476PU-N

USD 450.00

2 Weeks

LHX6 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 333-363 amino acids from the C-terminal region of Human LHX6.