Primary Antibodies

Jump to Filters
View as table Download
TH1L (NELFCD) Rabbit Polyclonal Antibody
TA344592

USD 475.00

5 Days

Rabbit Polyclonal Anti-TH1L Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TH1L antibody: synthetic peptide directed towards the N terminal of human TH1L. Synthetic peptide located within the following region: GEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLS
TH1L (NELFCD) Goat Polyclonal Antibody
TA311621

USD 375.00

5 Days

Goat Anti-TH1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NKRVSINKDE, from the internal region of the protein sequence according to NP_945327.1.