Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SSX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSX5 antibody: synthetic peptide directed towards the N terminal of human SSX5. Synthetic peptide located within the following region: NGDDAFVRRPRVGSQIPEKMQKHPWRQVCDRGIHLVNLSPFWKVGREPAS

Rabbit Polyclonal Anti-SSX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSX5 antibody: synthetic peptide directed towards the middle region of human SSX5. Synthetic peptide located within the following region: GRLQGIFPKITPEKPAEEGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKV

Rabbit Polyclonal Anti-SSX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SSX5 antibody is: synthetic peptide directed towards the C-terminal region of Human SSX5. Synthetic peptide located within the following region: ASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYE

Carrier-free (BSA/glycerol-free) SSX5 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SSX5 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SSX5 mouse monoclonal antibody, clone OTI3G6 (formerly 3G6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-SSX5 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SSX5

Rabbit Polyclonal Anti-SSX5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SSX5

SSX5 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications WB
Reactivities Human
Conjugation Unconjugated

SSX5 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

SSX5 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

SSX5 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications WB
Reactivities Human
Conjugation Unconjugated

SSX5 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications WB
Reactivities Human
Conjugation Unconjugated

SSX5 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

SSX5 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

SSX5 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications WB
Reactivities Human
Conjugation Unconjugated

SSX5 mouse monoclonal antibody, clone OTI3G6 (formerly 3G6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

SSX5 mouse monoclonal antibody, clone OTI3G6 (formerly 3G6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated