YY1 mouse monoclonal antibody, clone 4D2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
YY1 mouse monoclonal antibody, clone 4D2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
YY1 mouse monoclonal antibody, clone 4A5, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
YY1 (221-321) mouse monoclonal antibody, clone 2C4, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit polyclonal anti-YY1 antibody(N-term), Loading control
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This YY1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 74-104 amino acids from the N-terminal region of human YY1. |
Rabbit Polyclonal Anti-YY1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1. Synthetic peptide located within the following region: KQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPR |
Rabbit Polyclonal Anti-YY1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1. Synthetic peptide located within the following region: GADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGEN |
Rabbit Polyclonal Anti-YY1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-YY1 antibody: synthetic peptide directed towards the N terminal of human YY1. Synthetic peptide located within the following region: MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDD |