Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal anti-YY1 antibody(N-term), Loading control
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This YY1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 74-104 amino acids from the N-terminal region of human YY1. |
Rabbit Polyclonal Anti-YY1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1. Synthetic peptide located within the following region: KQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPR |
Rabbit Polyclonal Anti-YY1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1. Synthetic peptide located within the following region: GADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGEN |
Rabbit Polyclonal Anti-YY1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YY1 antibody: synthetic peptide directed towards the N terminal of human YY1. Synthetic peptide located within the following region: MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDD |
Active filters
Target Symbol
- YY1
Families
- Transcription Factors