Primary Antibodies

Jump to Filters
View as table Download
Galactoside 2 alpha L fucosyltransferase 1 (FUT1) Rabbit Polyclonal Antibody
TA334650

USD 375.00

5 Days

Rabbit Polyclonal Anti-FUT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUT1 antibody: synthetic peptide directed towards the middle region of human FUT1. Synthetic peptide located within the following region: EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL
Galactoside 2 alpha L fucosyltransferase 1 (FUT1) Rabbit Polyclonal Antibody
TA351200

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-FUT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FUT1