Primary Antibodies

View as table Download

SRPR beta (SRPRB) sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Canine, Chicken
Immunogen Synthetic peptide corresponding to amino acids 246-265 derived from the carboxyl terminal of the canine SRbeta subunit

Rabbit Polyclonal Anti-SRPRB Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRPRB antibody: synthetic peptide directed towards the middle region of human SRPRB. Synthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE

Rabbit Polyclonal Anti-SRPRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRPRB antibody: synthetic peptide directed towards the C terminal of human SRPRB. Synthetic peptide located within the following region: APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI

Rabbit Polyclonal Anti-SRPRB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein